PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01813.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 428aa    MW: 47824.6 Da    PI: 4.9254
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01813.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-172370148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT  Ed+ll+ +v ++G g+W+++ ++ g+ R++k+c++rw ++l
  Rsa1.0_01813.1_g00006.1 23 KGPWTSAEDQLLIAYVDKHGDGNWNAVQKHSGLSRCGKSCRLRWVNHL 70
                             79*******************************************996 PP

2Myb_DNA-binding43.86e-1476119146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++T  E+++ +++++ +G++ W++ a++++ gRt++++k++w++
  Rsa1.0_01813.1_g00006.1  76 KGSFTDKEEQRVIELHASMGNK-WARMAAELP-GRTDNEIKNFWNT 119
                              799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.5971874IPR017930Myb domain
SuperFamilySSF466891.99E-2820117IPR009057Homeodomain-like
SMARTSM007175.7E-152272IPR001005SANT/Myb domain
PfamPF002493.8E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-242477IPR009057Homeodomain-like
CDDcd001677.91E-122570No hitNo description
SMARTSM007177.3E-1475123IPR001005SANT/Myb domain
PROSITE profilePS5129418.74475125IPR017930Myb domain
PfamPF002496.4E-1376119IPR001005SANT/Myb domain
CDDcd001671.06E-978119No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2478123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGKVRHDSGG SGDDFAIDKN FHKGPWTSAE DQLLIAYVDK HGDGNWNAVQ KHSGLSRCGK  60
SCRLRWVNHL RPDLKKGSFT DKEEQRVIEL HASMGNKWAR MAAELPGRTD NEIKNFWNTR  120
VKRLQRLGLP IYPDEVREQA LNAAAQNGHN TDSLDGHHSQ ESLELDCLEI PEFDFKYLQL  180
NGCSSFYQSL LSSVPTGNQM RQNPALFQPN NIYNVIDSSY QPPPNRKRIR EPETAFPPYT  240
GGYAVSDQVW NYPSTPGQFN VAALQDSHFL GDATTTTTTY SSPSEPPLLH GEAEKLELPS  300
FQCFDTQDEP GDWETQHPMQ ALESDNTLVM SPLTSDCPSS FCDGLLESVV YGSSGEKQTD  360
PDSPLLHHSS LLDHIEITPA TANTAGHNSN AETDLVHFGP TSSNERRTSF ESGDWIRQLL  420
GEDRDYTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30231237106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00279DAPTransfer from AT2G26960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0765520.0KR076552.1 Brassica napus MYB transcription factor 81-2 (MYB81-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133920.10.0PREDICTED: transcription factor MYB104-like
TrEMBLM4C8K30.0M4C8K3_BRARP; Uncharacterized protein
STRINGBra000531.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.11e-153myb domain protein 81